PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo8G0061400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 215aa    MW: 24724.1 Da    PI: 8.6679
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo8G0061400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48e-191360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ +Ede+l+++v+ +G g+W+tI++  g+ R++k+c++rw +yl
   Spipo8G0061400 13 RGAWSSQEDEKLIKYVRTHGEGRWRTIPKAAGLLRCGKSCRLRWINYL 60
                     89******************************99************97 PP

2Myb_DNA-binding58.21.9e-1866109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w++
   Spipo8G0061400  66 RGNFTEDEDDLIIKLHALLGNR-WSLIAGRLP-GRTDNEIKNHWNS 109
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-25463IPR009057Homeodomain-like
PROSITE profilePS5129418.465860IPR017930Myb domain
SuperFamilySSF466896.97E-3111107IPR009057Homeodomain-like
SMARTSM007171.3E-141262IPR001005SANT/Myb domain
PfamPF002491.1E-161360IPR001005SANT/Myb domain
CDDcd001677.80E-111560No hitNo description
PROSITE profilePS5129428.81961115IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-2764116IPR009057Homeodomain-like
SMARTSM007178.3E-1765113IPR001005SANT/Myb domain
PfamPF002499.1E-1766109IPR001005SANT/Myb domain
CDDcd001671.06E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MKRNCCEKHT VNRGAWSSQE DEKLIKYVRT HGEGRWRTIP KAAGLLRCGK SCRLRWINYL  60
RPDIKRGNFT EDEDDLIIKL HALLGNRWSL IAGRLPGRTD NEIKNHWNSR LSRKLIRMGI  120
DPNKHRWSRR VPRAEHPALT IETCKSPPLC SDRVEDDGGV SREASCREDD LCPTSDLNLD  180
LTISLPFPLH GCEGQERSHE QTEETHSPTL LLFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-301111525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371802.12e-84PREDICTED: transcription repressor MYB6-like
SwissprotP813931e-70MYB08_ANTMA; Myb-related protein 308
TrEMBLQ8H2565e-84Q8H256_G
TrEMBLW5S7048e-84W5S704_9R
TrEMBLX2GMH58e-84X2GMH5_MALMI; MYB111
TrEMBLX2GR618e-84X2GR61_9R
STRINGVIT_01s0011g04760.t012e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-70myb domain protein 4